PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G13320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 312aa    MW: 34259.1 Da    PI: 4.7465
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G13320.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.48.2e-192067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd+llv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  LPERR03G13320.1 20 RGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 67
                     89********************************************97 PP

2Myb_DNA-binding51.91.7e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  LPERR03G13320.1  73 RGNITPQEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3571567IPR017930Myb domain
SuperFamilySSF466895.08E-3118114IPR009057Homeodomain-like
SMARTSM007171.1E-151969IPR001005SANT/Myb domain
PfamPF002495.8E-172067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-232174IPR009057Homeodomain-like
CDDcd001675.77E-122267No hitNo description
PROSITE profilePS5129423.58168122IPR017930Myb domain
SMARTSM007176.2E-1572120IPR001005SANT/Myb domain
PfamPF002492.1E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2375121IPR009057Homeodomain-like
CDDcd001672.81E-1177116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MAYERDTSSE EEVMGGDLRR GPWTVEEDLL LVNYIAAHGE GRWNSLARSA GLKRTGKSCR  60
LRWLNYLRPD LRRGNITPQE QLLILELHSR WGNRWSKIAQ HLPGRTDNEI KNYWRTRVQK  120
HAKQLKCDVN SQQFKDVMRY LWMPRLVERI QAAEQHQHDD MLLSSSWQHG SPDELPAPDN  180
AGCWPPAEYC AAAAAAAAAG AGQTPPPEVS STTTVGSSSP STEDSGTGAQ PSWEPAQVDW  240
FTTACDATSG AAGMAAVPAC QVGQSDLSSS LPAAAGLGFP DLAVADFEIS GFDVDSIWSM  300
DDDLWYNAQV TV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-251112018126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1205510.0AK120551.1 Oryza sativa Japonica Group cDNA clone:J013130B13, full insert sequence.
GenBankCT8306630.0CT830663.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA128H09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649985.11e-154PREDICTED: transcription factor WER-like
TrEMBLA0A0D9VTC60.0A0A0D9VTC6_9ORYZ; Uncharacterized protein
STRINGOB03G25040.11e-154(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.11e-84myb domain protein 112